PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI10G07430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 642aa    MW: 71715.5 Da    PI: 11.3269
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI10G07430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.13.7e-07324367348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++T+ +d+ l++++ +lG + Wk I r +  gRt    k+rw+ ++
  ORUFI10G07430.1 324 PFTARDDDELLRLHYRLGDR-WKEIGRAVY-GRTSRVMKHRWRELR 367
                      79****************99.********9.***********9875 PP

2Myb_DNA-binding23.21.6e-074464801247
                      HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      l+ +vk+ G ++W+++ r m+ +R++  c++rw  +
  ORUFI10G07430.1 446 LASLVKENGFRRWSRVTRSMP-RRSARLCRDRWCHH 480
                      889******************.***********877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001642.9E-36129225IPR006032Ribosomal protein S12/S23
Gene3DG3DSA:2.40.50.1404.6E-20140224IPR012340Nucleic acid-binding, OB-fold
SuperFamilySSF502492.48E-20140225IPR012340Nucleic acid-binding, OB-fold
PROSITE profilePS512948.003317371IPR017930Myb domain
SuperFamilySSF466897.48E-8320369IPR009057Homeodomain-like
SMARTSM007178.4E-4321369IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-8323366IPR009057Homeodomain-like
CDDcd001679.14E-4324366No hitNo description
SMARTSM007179.6443483IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-11446488IPR009057Homeodomain-like
CDDcd001671.43E-4446481No hitNo description
SuperFamilySSF466896.84E-15446528IPR009057Homeodomain-like
PROSITE profilePS500907.317446481IPR017877Myb-like domain
PfamPF139213.1E-6446493No hitNo description
PROSITE profilePS512948.808482536IPR017930Myb domain
SMARTSM007170.013486534IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-8489532IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003677Molecular FunctionDNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MGPTVFSSPH RWWDTCGLRG RRGCQIGVGE RERESRGNKR EVGERRRAPD HQAGAGSAPP  60
VAVADGSTRV GRQRGGGIYR REGGQIRAGA PTAGRRPRRH RRWRALWRCG CLPRTQIQAA  120
WRKTCGMGAG RKLKTHRRNQ RWADKAYKKS HLGNEWKKPF AGSSHAKGIV LEKIGIEAKQ  180
PNSAICKCAR VQLVKNGKKI AAFVPNDGCL NFIKENEVAY VDGIYGIRVL VDALSSSRLR  240
GRDGSGGDHG DATAAAAASR EVHRPPQAAA GMDAGGGRAA AAPRQGERLP PLEPGRQEHA  300
TPLREVVPRQ VAPPPRPRDV YHRPFTARDD DELLRLHYRL GDRWKEIGRA VYGRTSRVMK  360
HRWRELRRGG FLAAAARKEQ AALDMADDTV ETSEVEEPAD QSLPSLELQR STLADTLASS  420
FGSCSLATDH VMDPLAGSLA LGFACLASLV KENGFRRWSR VTRSMPRRSA RLCRDRWCHH  480
LARDVYHRPF TARDDDELLR LHYRLGDRWK KIGHAVYGRT SRVMNHRWRE LRRSSFLAAA  540
ARTEQTLDMA DDTVESEMEE SDQSLPTTRK SIIASGRKGS LQAGRPSACK PTTVKIADLR  600
RWRGRPPAKI IFAGGRWLVR SACENRNRPP TKKKKTSACE DR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v3p_SL3e-53123223310340S ribosomal protein S23
4v7e_BX3e-53123223310340S ribosomal protein S12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0QY040.0A0A0E0QY04_ORYRU; Uncharacterized protein
STRINGLOC_Os10g20990.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3110644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.17e-19myb domain protein 70